PNC-27

The Membrane-Active Anticancer Peptide: Selective Tumor Cell Destruction Through

HDM-2 Targeting and Pore-Mediated Necrosis

PNC-27 is a synthetic membrane-active peptide developed for in vitro oncology research. It was engineered to selectively target malignant cells through a unique, non-apoptotic mechanism involving direct interaction with cancer cell membranes. Unlike conventional chemotherapeutic agents that rely on intracellular signaling cascades or DNA damage, PNC-27 exerts its effects at the cell membrane level, making it a distinct research tool for studying cancer cell vulnerability. PNC-27 is derived from the HDM-2 (also known as MDM2) binding domain of the tumor suppressor protein p53 (amino acids 12–26) and is conjugated to a membrane-penetrating sequence called the membrane residency peptide (MRP). This design enables the peptide to recognize and bind membrane-associated HDM-2, a feature commonly observed in many cancer cell types but largely absent in normal, non-transformed cells. The peptide’s mechanism of action has been termed “poptosis” in the scientific literature— peptide-induced pore-mediated cell death. This represents a fundamentally new approach to cancer cell destruction that is independent of p53 signaling, apoptosis, or mitochondrial pathways. This makes PNC-27 especially valuable in research models involving p53-mutant or apoptosis-resistant cancer cells. PNC-27 has demonstrated activity across a wide range of malignancies in laboratory settings, including solid tumors (pancreatic, ovarian, uterine, cervical, melanoma, breast), hematologic malignancies (multiple leukemia cell lines and leukemia stem cells), and chemotherapy-resistant cancer cells. It has not been tested in human clinical trials and is available for research purposes only.

Peptide Information

Property Value Amino Acid Length 32 amino acids Sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG Molecular Formula C188H293N53O44S Molecular Weight 4,029.2 g/mol CAS Number 1159861-00-3 Synonyms Paralit, A6 Structure p53 residues 12–26 (HDM-2 binding domain) + MRP (membrane residency peptide)

How PNC-27 Works (Mechanism of Action) The defining research interest in PNC-27 lies in its mechanism of selective cytotoxicity, which operates through a physical membrane-disruption process fundamentally different from conventional anticancer agents.

HDM-2 Membrane Expression: The Cancer-Specific Target

Cancer cells frequently express HDM-2 on their plasma membranes, whereas normal cells typically localize HDM-2 intracellularly. This differential localization is the key to PNC-27’s selectivity. Research has demonstrated that HDM-2 membrane expression correlates with metastatic potential in primary tumor cell cultures and that HDM-2 colocalizes with E-cadherin in cancer cell plasma membranes. The levels of membrane HDM-2 expression have been found to correlate directly with the IC50 for PNC-27-induced cell killing.

Membrane Pore Formation: The Two-Step Process

PNC-27 kills cancer cells through a well-characterized two-step process:

• Step 1 (Temperature-Independent Binding): PNC-27 binds specifically to membrane-

bound HDM-2, forming stable 1:1 peptide–protein complexes. This binding step occurs even at 17°C and does not require membrane fluidity.

• Step 2 (Temperature-Dependent Pore Assembly): The PNC-27–HDM-2 complexes

dimerize and co-migrate within the cell membrane to assemble into transmembrane pores. This step is strongly temperature-dependent and requires membrane fluidity (occurs at 37°C). The result is rapid loss of membrane function, explosive release of intracellular contents, and necrotic cell death—the process termed “poptosis.” Immuno-scanning electron microscopy has directly imaged these transmembrane pores, revealing ring-shaped structures containing PNC- 27–HDM-2 complexes in approximately 1:1 ratios.

Independence from Apoptotic Pathways

This process is independent of the p53 signaling pathway, apoptosis, or mitochondrial involvement. PNC-27 has been shown to kill cancer cells that are p53-homozygously deleted (such as K562 leukemia cells), confirming that its mechanism operates entirely independently of p53 activity. This makes PNC-27 especially valuable for targeting cancers that have developed resistance to apoptosis-based therapies.

Mitochondrial Disruption

Recent research has also demonstrated that PNC-27 enters cancer cells and binds to the membranes of mitochondria, resulting in their disruption. This additional mechanism may contribute to the peptide’s overall cytotoxic effects on cancer cells.

Selectivity for Cancer Cells

A central finding across multiple studies is PNC-27’s selective activity:

• Normal cells, including hematopoietic stem cells and non-malignant epithelial cells, show

minimal to no susceptibility due to the absence of HDM-2 on their outer membranes.

• Cancer cells with high membrane HDM-2 expression demonstrate dose-dependent

membrane disruption and cell death.

• When researchers artificially forced normal cells (MCF-10-2A) to express HDM-2 on

their membranes, those cells became susceptible to PNC-27, confirming that membrane HDM-2 is both necessary and sufficient for PNC-27 cytotoxicity.

• PNC-28, a shorter analog, was found to have no effect on the ability of human

hematopoietic stem cells from cord blood to differentiate into mature hematopoietic cells, strongly suggesting that these peptides would not suppress bone marrow during cancer treatment.

Research Applications and Potential Benefits

PNC-27’s benefits are documented exclusively in laboratory (in vitro) and preclinical (animal model) research. No human clinical trials have been conducted.

Broad-Spectrum Anticancer Activity

In laboratory and preclinical research settings, PNC-27 has demonstrated activity across a wide range of malignancies:

• Solid tumors: pancreatic (MIA-PaCa-2, BMRPA1-TUC-3), ovarian, uterine, cervical

(HTB-35, SW756, HeLa), melanoma (A2058), and breast cancer (MCF-7) cell lines

• Hematologic malignancies: chronic myeloid leukemia (K562), acute monocytic leukemia

(U937), acute myelomonocytic leukemia (OCI-AML3), and acute promyelocytic leukemia (HL-60)

• Leukemia stem cells from patient-derived acute myelogenous leukemia samples
• Chemotherapy-resistant cancer cells and primary tumor cells isolated ex vivo

Selectivity—Sparing Normal Cells

PNC-27 demonstrates minimal to no cytotoxicity to normal cells, including hematopoietic stem cells from cord blood, non-malignant epithelial cells, primary normal cervical epithelial cells (PCS-480-011), and untransformed fibroblasts. This selectivity is one of its most compelling research features.

Efficacy Against Apoptosis-Resistant Cancers

Because PNC-27 kills through membrane pore formation rather than apoptosis, it is effective against cancer cells that have developed resistance to apoptosis-based therapies, including p53- mutant and p53-deleted cancers.

In Vivo Tumor Eradication

Animal model research has demonstrated PNC-27’s ability to eradicate highly metastatic pancreatic tumors and stem-cell-enriched human acute myelogenous leukemias in nude mice, with no evidence of off-target effects.

Potential Synergy with Metabolic Agents

Recent research (2025) has demonstrated that lithium acetoacetate (a ketone body) significantly lowers the IC50 values for PNC-27 when administered alongside the peptide to cervical cancer cells, suggesting potential for combination strategies.

Cancer Research Tool

PNC-27 is frequently used in research exploring cancer cell membrane composition and protein localization, HDM-2 biology beyond its canonical intracellular role, necrotic versus apoptotic cell death pathways, novel anticancer strategies that bypass intracellular resistance mechanisms, and therapeutic concepts for targeting cancer stem cells and resistant tumor populations.

What the Science Shows

PNC-27 has been studied extensively in laboratory and preclinical settings with a robust body of peer-reviewed publications.

Sarafraz-Yazdi et al. (2010), Proceedings of the National Academy of Sciences This landmark PNAS study established the structural and mechanistic basis for PNC-27’s cancer selectivity:

• Demonstrated that the 3D structure of PNC-27’s p53 residues is directly superimposable

on the structure of those residues bound to HDM-2

• Found significant levels of HDM-2 in the membranes of four different cancer cell lines

but not in three different untransformed cell lines

• When untransformed MCF-10-2A cells were forced to express membrane HDM-2, they

became susceptible to PNC-27

• Confirmed that PNC-27 induces tumor cell necrosis and not apoptosis

Davitt et al. (2014), Annals of Clinical and Laboratory Science This study extended PNC-27 research to non-solid tissue tumors:

• Demonstrated that K562 leukemia cells (p53-homozygously deleted) strongly express

HDM-2 in their membranes

• PNC-27 colocalized with membrane HDM-2 and induced nearly 100% cell killing with

LDH release

• No effect on lymphocyte control cells
• Confirmed that PNC-27’s mechanism is independent of p53 activity

Shaikh et al. (2020), Anticancer Research — Leukemia Studies

This study investigated PNC-27 activity across three acute myelogenous leukemia cell lines:

• HDM-2 was expressed at high levels in membranes of U937, OCI-AML3, and HL-60

cells (confirmed by flow cytometry)

• PNC-27 induced cell necrosis and LDH release within 4 hours
• Concluded that targeting membrane HDM-2 represents a potential strategy to treat

leukemia

Sarafraz-Yazdi et al. (2022), Biomedicines — Pore Structure Imaging This study used immuno-scanning electron microscopy to directly image PNC-27-induced pores:

• Visualized ring-shaped structures containing PNC-27–HDM-2 complexes in

approximately 1:1 ratios

• Confirmed the two-step binding and pore assembly mechanism
• No pores formed in PNC-27-treated untransformed fibroblasts

Pincus et al. (2024), Biomedicines — Comprehensive Poptosis Review This comprehensive review described the full state of PNC-27 research:

• Documented successful treatment of metastatic pancreatic tumors and stem-cell-enriched

AML in nude mice with no off-target effects

• Confirmed that PNC-28 does not affect hematopoietic stem cell differentiation
• Reviewed the complete mechanistic understanding of the poptosis pathway
• Also identified additional mitochondrial disruption mechanisms in cancer cells

Miller et al. (2025), Medical Research Archives — Cervical Cancer The most recent study demonstrated PNC-27 activity against cervical cancer:

• Killed three cervical cancer cell lines (HTB-35, SW756, HeLa) with IC50 values among

the lowest observed for any cancer type tested

• No effect on PCS-480-011 primary normal cervical epithelial cells
• Lithium acetoacetate (a ketone body) significantly enhanced PNC-27’s efficacy when

used in combination

Dosing Protocol

PNC-27 is a research compound. There are no established human dosing protocols, no FDA- approved therapeutic doses, and no human clinical trials. The following information is derived exclusively from published in vitro and preclinical research.

In Vitro Research Concentrations

Published studies have used PNC-27 at the following concentration ranges in cell culture experiments:

Application Concentration Range Context Cytotoxicity assays 50–300 µg/mL Dose-dependent cell killing Standard research dose 200 µg/mL Used in control experiments IC50 values (varies by cell line) ~100–200 µg/mL Cell-line dependent

These concentrations are for controlled laboratory use only and should not be extrapolated to any human application.

Reconstitution Instructions (Research Use) PNC-27 is supplied as a lyophilized powder. For in vitro research reconstitution: 1. Remove the cap from the vial and wipe the stopper with an alcohol swab. 2. Add sterile water or appropriate buffer (such as PBS) to the desired concentration. 3. Allow the peptide to dissolve without aggressive shaking. Gently swirl if needed. 4. The solution should be clear. Do not use if cloudy or if it contains particles. 5. Aliquot into single-use portions to avoid repeated freeze-thaw cycles. 6. Label with the date, concentration, and storage conditions.

Side Effects

There are no human clinical trial data for PNC-27. All safety information is derived from in vitro and preclinical animal research.

Preclinical Safety Profile

• In all published studies, PNC-27 demonstrated no cytotoxicity to normal cells, including

hematopoietic stem cells, non-malignant epithelial cells, untransformed fibroblasts, and primary normal cervical epithelial cells.

• PNC-28 (the shorter analog) did not affect the differentiation of human hematopoietic

stem cells from cord blood, suggesting these peptides would not suppress bone marrow function.

• Animal studies (nude mice) showed tumor eradication with no evidence of off-target

effects.

Theoretical Concerns

• Any normal cells with abnormal HDM-2 membrane expression could theoretically be

affected.

• Long-term systemic effects in humans are completely unknown.
• Immune response to the peptide has not been characterized in humans.
• Interactions with other medications are unknown.

Important Limitation

The absence of reported side effects reflects the limited scope of in vitro and preclinical research, not proof of safety in humans. PNC-27 has not been tested in human clinical trials.

Contraindications and Precautions

Because PNC-27 has not been tested in humans, formal contraindications do not exist. The following are theoretical considerations based on the peptide’s mechanism of action:

• Pregnancy and breastfeeding: Not studied; avoid.
• Autoimmune conditions: Effects on immune function are unknown.
• Concurrent chemotherapy: Interactions with other anticancer agents are not established.
• Immunocompromised individuals: Effects on immune cell populations are not fully

characterized. PNC-27 is intended strictly for in vitro laboratory research. Any other use is outside the scope of current scientific evidence.

Comparison to Other Anticancer Peptide Research Compounds

Compound Mechanism Target Selectivity Development Stage PNC-27 Membrane pore Membrane HDM- Cancer-specific Preclinical / in vitro formation 2 (high) (poptosis) PNC-28 Membrane pore Membrane HDM- Cancer-specific Preclinical / in vitro formation 2 (high)

FOXO4-DRI Disrupts FOXO4– Senescent cells Senescent cell- Preclinical / in vitro p53 interaction specific ABT-263 BCL-2 family Anti-apoptotic Moderate Phase 2 clinical trials (Navitoclax) inhibitor proteins LL-37 Membrane Cell membranes Low (non- Preclinical (Cathelicidin) disruption (broad) specific)

PNC-27 is unique among anticancer research peptides in that it exploits a cancer-specific membrane target (HDM-2) to induce physical membrane destruction through pore formation. This mechanism bypasses all intracellular resistance pathways, making it a complementary research contrast to kinase inhibitors, DNA-damaging agents, and immune-mediated approaches. PNC-28, the shorter analog containing p53 residues 17–26 linked to the same MRP, operates through the same mechanism and has shown similar selectivity, providing a valuable comparative tool in this research area.

Research Best Practices

Proper Storage is Critical

PNC-27 is a complex 32-amino-acid peptide. Proper storage in lyophilized form at −20°C or below and avoidance of repeated freeze-thaw cycles after reconstitution are essential for maintaining peptide integrity and reproducible experimental results.

Use Appropriate Controls

Published studies consistently use PNC-29 (a negative control peptide derived from cytochrome P450 with the same MRP sequence) as the control. This peptide has no effect on cancer or normal cells and serves as the standard negative control in PNC-27 experiments.

Confirm HDM-2 Membrane Expression

PNC-27’s efficacy depends on membrane HDM-2 expression. Flow cytometry or immunofluorescence to confirm membrane HDM-2 levels in the target cell line before PNC-27 treatment is recommended, as the extent of membrane HDM-2 expression correlates with the IC50 for PNC-27-induced killing.

Include Normal Cell Controls

Always include matched non-malignant cell lines as negative controls to confirm selectivity in each experimental system.

Aliquot After Reconstitution

To avoid degradation from repeated freeze-thaw cycles, aliquot reconstituted PNC-27 into single-use portions and store at −20°C or below.

Storage and Handling

Lyophilized Powder

• Store at −20°C or below
• Protect from light
• Stable for extended periods when stored properly in lyophilized form
• No fillers are used in preparation

After Reconstitution

• Aliquot into single-use portions to avoid repeated freeze-thaw cycles
• Store aliquots at −20°C or below
• Use within 28 days if stored at 2°C to 8°C
• Discard if the solution becomes cloudy or contains particles

Legal Status

United States: PNC-27 is not FDA approved for any medical use. It has not entered human clinical trials. It is available as a research chemical through peptide suppliers for in vitro laboratory research only. International: Generally available for research purposes. Not approved for therapeutic use in any jurisdiction. Important: PNC-27 is not a drug, food, or cosmetic. It is intended strictly for controlled in vitro research and laboratory experimentation by qualified professionals.

Frequently Asked Questions

How does PNC-27 kill cancer cells? PNC-27 binds to HDM-2 protein expressed on the membranes of cancer cells (but not normal cells), forming complexes that assemble into transmembrane pores. This causes rapid loss of membrane integrity and necrotic cell death through a process called poptosis. The mechanism is independent of p53 signaling and apoptosis. Does PNC-27 affect normal cells?

In all published studies, PNC-27 has shown minimal to no cytotoxicity to normal cells. This selectivity occurs because normal cells do not express significant levels of HDM-2 on their outer membranes. The peptide has been tested against hematopoietic stem cells, fibroblasts, and multiple non-malignant epithelial cell types with no adverse effects. Can PNC-27 work against chemotherapy-resistant cancers? Yes, in laboratory settings. Because PNC-27 kills through physical membrane disruption rather than intracellular signaling, it bypasses the resistance mechanisms that render many cancer cells insensitive to conventional chemotherapy. It has been effective against p53-mutant and p53- deleted cancer cell lines. What is the difference between PNC-27 and PNC-28? PNC-28 is a shorter analog containing p53 residues 17–26 (instead of 12–26) linked to the same membrane residency peptide. Both operate through the same HDM-2-targeting, pore-forming mechanism and show similar cancer selectivity. Has PNC-27 been tested in humans? No. PNC-27 has been studied only in cell culture (in vitro) and animal models (preclinical). No human clinical trials have been conducted. It is available for research purposes only. What types of cancer has PNC-27 been tested against? In laboratory settings, PNC-27 has demonstrated activity against pancreatic, ovarian, uterine, cervical, melanoma, and breast cancer cell lines, as well as multiple leukemia cell lines (K562, U937, OCI-AML3, HL-60) and patient-derived leukemia stem cells. What is poptosis? Poptosis is a term coined to describe peptide-induced transmembrane pore formation leading to cancer cell necrosis. It is mechanistically distinct from apoptosis (programmed cell death) and represents a novel mode of cancer cell destruction.

References

1. Sarafraz-Yazdi E, Bowne WB, Adler V, et al. Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes. Proceedings of the National Academy of Sciences. 2010;107(5):1918-1923. 2. Sarafraz-Yazdi E, Mumin S, Engel D, et al. PNC-27, a chimeric p53-penetratin peptide binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation and leads to cancer cell lysis. Biomedicines. 2022;10(5):945. 3. Davitt K, Babcock BD, Fenelus M, et al. The anti-cancer peptide, PNC-27, induces tumor cell necrosis of a poorly differentiated non-solid tissue human leukemia cell line that depends on expression of HDM-2 in the plasma membrane of these cells. Annals of Clinical and Laboratory Science. 2014;44(3):241-248. 4. Shaikh MF, Morano WF, Lee J, et al. Targeting membrane HDM-2 by PNC-27 induces necrosis in leukemia cells but not in normal hematopoietic cells. Anticancer Research. 2020;40(9):4857-4867. 5. Pincus MR, Silberstein M, Zohar N, Sarafraz-Yazdi E, Bowne WB. Poptosis or peptide- induced transmembrane pore formation: a novel way to kill cancer cells without affecting normal cells. Biomedicines. 2024;12(6):1144. 6. Bowne WB, Sookraj KA, Vishnevetsky M, et al. The penetratin sequence in the anticancer PNC-28 peptide causes tumor cell necrosis rather than apoptosis of human pancreatic cancer cells. Annals of Surgical Oncology. 2008;15(12):3588-3600. 7. Miller AI, et al. PNC-27 kills cervical cancer cells but not untransformed cervical cells, an effect that is enhanced by ketone bodies. Medical Research Archives. 2025;13(5). 8. Pincus MR, Bowne WB, Sarafraz-Yazdi E. Anti-cancer peptide PNC-27 kills cancer cells by unique interactions with plasma membrane-bound HDM-2 and with mitochondrial membranes causing mitochondrial disruption. Cancer Research. 2024. 9. Sarafraz-Yazdi E, Salame G, Gorelick C, et al. PNC-27 induces dose-dependent cytotoxicity in primary human ovarian and uterine cancer cells. Cancer Investigation. 2012;30(6):413-421. 10. Rahmani R, Darroudi M, Gharanfoli M, et al. Conjugated PNC-27 peptide/PEI- superparamagnetic iron oxide nanoparticles (SPIONs) as a double targeting agent for early cancer diagnosis: in vitro study. Iranian Journal of Basic Medical Sciences. 2022;25(10):1234-1242.