← Back to Compound Library WEIGHT LOSS / METABOLIC

Cagrilintide

The Long-Acting Amylin Analog Redefining Weight Management Through Dual Pathway

Activation

Cagrilintide is a long-acting amylin analog that works through a completely different pathway than GLP-1 drugs like semaglutide. While GLP-1 receptor agonists have dominated the weight loss conversation, cagrilintide offers something unique: it can be combined with semaglutide to produce even greater results than either drug alone. Amylin is a hormone the pancreas releases alongside insulin after meals. It signals the brain that the body is full, slows down digestion, and helps regulate blood sugar. The problem is that natural amylin breaks down quickly in the body. Cagrilintide is engineered with N-terminal lipidation that extends its half-life by binding to albumin, which is why it only needs to be injected once per week. The real excitement around cagrilintide is the combination therapy called CagriSema, which pairs it with semaglutide. In the REDEFINE 1 trial, published in the New England Journal of Medicine in 2025, this combination produced over 20% average weight loss, with more than half of participants losing 20% or more of their body weight. Cagrilintide is classified as a dual amylin and calcitonin receptor agonist (DACRA). It simultaneously targets multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems. It is currently in Phase 3 clinical trials and is not yet FDA approved but is available through research peptide suppliers.

Peptide Information

Property Value Peptide Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Molecular Formula C194H312N54O59S2 Molecular Weight 4,409 g/mol CAS Number 1415456-99-3 Half-Life Approximately 7 to 8 days Classification Dual amylin and calcitonin receptor agonist (DACRA)

How Cagrilintide Works (Mechanism of Action) To understand cagrilintide, it is necessary to understand why combining it with semaglutide produces superior results and how the amylin pathway differs from the GLP-1 pathway.

The Amylin Pathway

Amylin receptors in the brain, particularly in areas that control hunger and satiety, are different from GLP-1 receptors. When cagrilintide activates these receptors, it creates feelings of fullness through a separate signaling system than what semaglutide uses. Cagrilintide acts on both amylin and calcitonin receptors, which is why it is classified as a dual amylin and calcitonin receptor agonist (DACRA).

Slowed Gastric Emptying

Like GLP-1 drugs, cagrilintide slows down how fast food leaves the stomach. This means meals keep the body satisfied longer. The delayed gastric emptying also contributes to more stable blood sugar levels after eating.

Why the Combination Works

The key insight behind CagriSema is that semaglutide and cagrilintide work through different receptor systems. When both are activated at the same time, the satiety signals stack. The brain receives the “stop eating” message through two separate channels instead of one. Semaglutide is already effective on its own. But some people hit a plateau or still experience significant hunger. Adding cagrilintide gives the body another tool to suppress appetite without simply increasing the semaglutide dose. This dual-pathway approach targets both homeostatic (energy balance) and hedonic (reward-driven) eating behaviors.

The Half-Life Advantage

Cagrilintide has a half-life of approximately 7 to 8 days, which supports stable blood levels with once-weekly dosing. The N-terminal lipidation allows it to bind to albumin in the bloodstream, dramatically extending its duration of action compared to native amylin.

Benefits

Greater Weight Loss When Combined with Semaglutide

The REDEFINE 1 trial showed CagriSema (cagrilintide 2.4 mg plus semaglutide 2.4 mg) produced an average weight loss of 20.4% over 68 weeks. More than half of participants lost 20% or more of their body weight.

Effective as a Standalone Therapy

Even without semaglutide, cagrilintide produced meaningful results. In Phase 2 trials, the 4.5 mg dose produced approximately 11% weight loss over 26 weeks. That result actually outperformed liraglutide (Saxenda) head to head at its approved dose.

Different Mechanism Than GLP-1 Drugs

For individuals who have tried semaglutide or tirzepatide and still struggle with hunger, cagrilintide works through a different pathway. This makes it a potential add-on rather than a replacement.

Blood Sugar Improvements

While not as powerful as GLP-1 drugs for glucose control, cagrilintide does improve glycemic markers. The combination with semaglutide enhances this effect. Preliminary research also suggests potential benefits in the context of type 2 diabetes management.

Once-Weekly Dosing

The long half-life means only one injection per week is needed, the same frequency as semaglutide. This convenience supports better adherence to the treatment protocol.

Potential Cardiovascular Benefits

Emerging research suggests that amylin-based therapies may have beneficial effects at the intersection of obesity and cardiovascular health, though this area remains under investigation.

What the Science Shows

Cagrilintide has been studied in multiple Phase 1, 2, and 3 clinical trials with robust data supporting its efficacy.

Phase 2 Monotherapy Trial

Lau et al. (2021), The Lancet

This trial enrolled 706 participants with obesity who received cagrilintide at various doses or placebo for 26 weeks. Results by dose:

At the highest dose, cagrilintide outperformed liraglutide 3.0 mg (10.8% versus 9.0%), demonstrating superior efficacy to an already-approved weight management medication.

Phase 1b Combination Trial

Enebo et al. (2021), The Lancet

This trial tested cagrilintide combined with semaglutide over 20 weeks. The combination of cagrilintide 2.4 mg plus semaglutide 2.4 mg produced 17.1% weight loss, compared to approximately 10% with semaglutide alone. This demonstrated a significant boost from adding the second compound.

REDEFINE 1 Trial (Phase 3)

Garvey et al. (2025), New England Journal of Medicine

This is the pivotal Phase 3 trial. A total of 3,417 adults received CagriSema, semaglutide alone, cagrilintide alone, or placebo for 68 weeks. Results:

Preclinical Receptor Studies

Larsen et al. (2022), Biomedicine and Pharmacotherapy This preclinical study compared cagrilintide with another DACRA compound (KBP-336) and examined how receptor balance between amylin and calcitonin receptors affects metabolic outcomes, providing deeper insight into the pharmacology of dual receptor agonism.

Type 2 Diabetes Data

Frias et al. (2023), Diabetes Preliminary data presented at scientific conferences demonstrated the efficacy and safety of coadministered semaglutide and cagrilintide specifically in patients with type 2 diabetes, expanding the potential clinical applications beyond obesity alone.

Systematic Review and Meta-Analysis

Dutta et al. (2024), Indian Journal of Endocrinology and Metabolism This systematic review and meta-analysis compiled data across multiple cagrilintide trials, confirming the efficacy and safety profile of cagrilintide both as monotherapy and in combination with semaglutide (CagriSema) for weight management.

Dosing Protocol

Cagrilintide follows a gradual titration schedule similar to other incretin therapies. This protocol is based on the Phase 3 REDEFINE trial design. Subcutaneous injection once weekly.

Standard Titration Schedule

Weeks Dose Weeks 1 to 4 0.25 mg Weeks 5 to 8 0.5 mg Weeks 9 to 12 1.0 mg Weeks 13 to 16 1.7 mg Week 17 and onward 2.4 mg (maintenance)

If Combining with Semaglutide

Both compounds are titrated at the same time using the same 4-week escalation schedule. At maintenance, both are dosed at 2.4 mg weekly. They are injected separately unless a combined formulation is available.

Important Dosing Notes

a lower dose is working and is well tolerated.

up.

Draw Volumes by Vial Size

5 mg Vial (2 mL reconstitution = 2.5 mg/mL) — Recommended

Dose Volume Units on Syringe 0.25 mg 0.10 mL 10 units 0.50 mg 0.20 mL 20 units 1.0 mg 0.40 mL 40 units 1.7 mg 0.68 mL 68 units 2.4 mg 0.96 mL 96 units

Vial duration at 2.4 mg per week: approximately 2 weeks. This reconstitution is recommended because volumes are easy to measure at all titration steps.

5 mg Vial (1 mL reconstitution = 5 mg/mL)

Dose Volume Units on Syringe 0.25 mg 0.05 mL 5 units 0.50 mg 0.10 mL 10 units 1.0 mg 0.20 mL 20 units 1.7 mg 0.34 mL 34 units 2.4 mg 0.48 mL 48 units

Vial duration at 2.4 mg per week: approximately 2 weeks. This concentration works well once higher doses are reached, but early titration doses become harder to measure accurately.

Reconstitution Instructions

1. Draw the appropriate amount of bacteriostatic water into a sterile syringe (2 mL recommended for this peptide). 2. Inject slowly down the inside wall of the vial to avoid foaming. 3. Gently swirl or roll the vial until the peptide is fully dissolved. Do not shake. 4. The solution should be clear and colorless. Do not use if cloudy or if it contains particles. 5. Label the vial with the reconstitution date and concentration. 6. Refrigerate at 36°F to 46°F (2°C to 8°C). 7. Use within 28 days.

Side Effects

Common Effects (Clinical Trial Data) The side effects are similar to GLP-1 drugs. If combining cagrilintide with semaglutide, gastrointestinal effects may be more pronounced, especially during titration.

These typically improve after the first few weeks at each dose level. The slow titration schedule is specifically designed to minimize these effects.

Less Common Effects

When to Contact a Medical Professional

Contraindications and Precautions

Use with Caution

Drug Interactions

When combined with insulin or sulfonylureas, those doses may need reduction to prevent low blood sugar. Cagrilintide slows gastric emptying, which can affect how quickly oral medications are absorbed.

Pregnancy and Breastfeeding

Not studied in pregnant or breastfeeding women. Avoid use during pregnancy.

Comparison to Similar Compounds

Compound Mechanism Weight Loss Route Frequency Status Cagrilintide Amylin/calcitonin ~11% (mono) SubQ Weekly Phase 3 (DACRA) CagriSema Amylin + GLP-1 ~20% SubQ Weekly Phase 3 Semaglutide GLP-1 agonist ~16% SubQ Weekly FDA approved Tirzepatide GLP-1/GIP dual ~21% SubQ Weekly FDA approved Liraglutide GLP-1 agonist ~8% SubQ Daily FDA approved

Tirzepatide (dual GLP-1/GIP) produces approximately 21% weight loss. CagriSema (amylin plus GLP-1) produces approximately 20% weight loss. They are roughly comparable but work through different mechanisms. Cagrilintide as a standalone outperformed liraglutide in head-to- head comparison and offers a unique add-on option for individuals already on GLP-1 therapy who have plateaued.

Success Tips

Managing Side Effects

Start with the lowest dose and follow the titration schedule strictly. Eat smaller meals. Avoid greasy, fried, or spicy foods during titration. Ginger tea can help with nausea.

Protein Matters

Reduced appetite makes it easy to undereat, and if protein intake is insufficient, muscle loss will occur. Aim for 1.0 to 1.2 grams of protein per kilogram of body weight daily. Make it a priority at every meal.

Stay Hydrated

Set reminders to drink water. Dehydration makes nausea and constipation worse.

If Stacking with Semaglutide

Titrate both compounds slowly. Be prepared for stronger gastrointestinal side effects during the adjustment period. The combination is highly effective but requires patience. If the side effects are too intense, consider staying at a lower dose of one or both compounds for longer.

Keep Training

Walk daily. Lift weights 2 to 3 times per week. Peptides enhance the basics. They do not replace them.

Injection Technique

1. Wash hands thoroughly with soap and water. 2. Clean the vial stopper with an alcohol swab and allow it to air dry. 3. Draw the appropriate dose into a sterile insulin syringe. 4. Clean the injection site with an alcohol swab. 5. Pinch a skinfold and insert the needle at 45 to 90 degrees into subcutaneous tissue. 6. Do not aspirate for subcutaneous injections. 7. Inject slowly and steadily. 8. Withdraw the needle and apply light pressure with gauze if needed. 9. Dispose of the syringe immediately in a sharps container. Never recap needles. 10. Rotate injection sites weekly (abdomen, thighs, upper arms) at least 1 inch apart.

Storage and Handling

Before Reconstitution

After Reconstitution

Legal Status

United States: Not FDA approved. Currently in Phase 3 clinical trials (REDEFINE program). Official access is limited to trial enrollment. Research Peptide Market: Cagrilintide is available from research chemical suppliers in lyophilized powder form. Future Outlook: If Phase 3 trials continue to show positive results, Novo Nordisk is expected to seek FDA approval in the coming years. The combination product CagriSema is the primary focus of development.

Frequently Asked Questions

How is cagrilintide different from semaglutide?

Semaglutide works through GLP-1 receptors. Cagrilintide works through amylin and calcitonin receptors. They target different pathways, which is why combining them produces greater weight loss than either compound alone. Can I use cagrilintide by itself? Yes. Monotherapy trials showed approximately 11% weight loss at the highest dose over 26 weeks. It works on its own, but the combination with semaglutide is more effective. How does CagriSema compare to tirzepatide? Tirzepatide (dual GLP-1/GIP) produces approximately 21% weight loss. CagriSema (amylin plus GLP-1) produces approximately 20% weight loss. They are roughly comparable but work through different mechanisms. What if I miss a dose? Take it as soon as possible if it has been less than a few days. Otherwise, skip the missed dose and resume the regular schedule. Can I stack it with tirzepatide instead of semaglutide? This has not been studied in clinical trials. The researched combination is cagrilintide plus semaglutide. Stacking with tirzepatide would be speculative, though early preclinical data from Valdecantos et al. (2024) has examined the combination of cagrilintide and tirzepatide in animal models. Is nausea unavoidable? Most people experience some nausea, but slow titration significantly reduces severity. It typically improves after the first few weeks at each dose level. Eating smaller, blander meals and staying hydrated also helps.

What is DACRA?

DACRA stands for dual amylin and calcitonin receptor agonist. It describes the receptor pharmacology of cagrilintide, which activates both amylin receptors and calcitonin receptors. This dual receptor activity contributes to its effects on appetite, gastric emptying, and metabolic signaling.

References

1. Lau DCW, Erichsen L, Francisco A, et al. Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double- blind, placebo-controlled and active-controlled, dose-finding phase 2 trial. The Lancet. 2021;398:2160-2172. 2. Enebo LB, Berthelsen KK, Kankam M, et al. Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with

semaglutide 2.4 mg for weight management: a randomised, controlled, phase 1b trial. The Lancet. 2021;397:1736-1748. 3. Garvey WT, et al. Coadministered cagrilintide and semaglutide in adults with overweight or obesity (REDEFINE 1). New England Journal of Medicine. 2025. 4. Kruse T, et al. Development of cagrilintide, a long-acting amylin analogue. Journal of Medicinal Chemistry. 2021. 5. Larsen A, Mohamed K, Sonne N, et al. Does receptor balance matter? Comparing the efficacies of the dual amylin and calcitonin receptor agonists cagrilintide and KBP-336 on metabolic parameters in preclinical models. Biomedicine and Pharmacotherapy. 2022;156:113842. 6. Valdecantos P, Rada P, Ghosh S, Rondinone C, Valverde A. Beneficial effect of the combination therapy of cagrilintide, a dual amylin/calcitonin agonist, and tirzepatide, a dual GLP-1/GIP agonist, on body weight loss in obese rats. Diabetes. 2024. 7. Mikhail N. Cagrilintide combined with semaglutide: a new approach for treatment of obesity and type 2 diabetes. Clinical Research and Clinical Trials. 2023. 8. Frias JP, Deenadayalan S, Erichsen L, et al. Efficacy and safety of coadministered semaglutide and cagrilintide in type 2 diabetes. Diabetes. 2023. 9. Dutta D, Nagendra L, Harish B, et al. Efficacy and safety of cagrilintide alone and in combination with semaglutide (CagriSema) as anti-obesity medications: a systematic review and meta-analysis. Indian Journal of Endocrinology and Metabolism. 2024;28:436-444. 10. Badshah I. Unlocking the potential: amylin-based therapies as novel interventions for addressing the nexus of obesity and cardiovascular health. Journal of Endocrinology and Metabolic Research. 2024;5(1):19-35. 11. ClinicalTrials.gov. REDEFINE clinical program (NCT05567796).

Property Support

Our Property Support services are designed to help homeowners, property managers, and businesses maintain safe, clean, and well-functioning properties year-round.